Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : M2BUJ0
dbSWEET id: dbswt_1860
Accession: M2BUJ0
Uniprot status: Unreviewed
Organism: Treponema denticola
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|M2BUJ0|M2BUJ0_TREDN|Unreviewed|Treponema denticola|86
MNSKFFTILGWVATATAMAMYVSYIPQISNNLSGMKGNWLQPLVAAINCILWVTYGLMKK
PKRDWPIAFANSPGIIFGLVAFITAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: M2BUJ0_inward.pdb Alignment file: M2BUJ0_inw.pir Procheck score ⇒ Ramachandran plot: 91.5% favored 6.9% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: M2BUJ0_outward.pdb Alignment file: M2BUJ0_out.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 8.5% allowed .0% week .8% disallowed Occluded: Model structure: M2BUJ0_occluded.pdb Alignment file: M2BUJ0_occ.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 5.4% allowed 2.3% week 3.1% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA