Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M2BRK5

dbSWEET id: dbswt_1859

Accession:   M2BRK5

Uniprot status:   Unreviewed

Organism:   Treponema denticola

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Spirochaetes ⇒ Spirochaetales ⇒ Spirochaetaceae ⇒ Treponema.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|M2BRK5|M2BRK5_TREDN|Unreviewed|Treponema denticola|86
MNSKFFAVLGWVATATAMAMYVSYIPQISNNLSGMKGNWLQPLVAAINCTLWVTYGLMKK
PKRDWPIAFANSPGIFFGLVAFITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  M2BRK5_inward.pdb    Alignment file: M2BRK5_inw.pir

Procheck score ⇒ Ramachandran plot: 86.9% favored    10.8% allowed    1.5% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  M2BRK5_outward.pdb    Alignment file: M2BRK5_out.pir

Procheck score ⇒ Ramachandran plot: 93.1% favored    6.2% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  M2BRK5_occluded.pdb    Alignment file: M2BRK5_occ.pir

Procheck score ⇒ Ramachandran plot: 91.5% favored    5.4% allowed    2.3% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur