Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M1D7G9

dbSWEET id: dbswt_226

Accession:   M1D7G9

Uniprot status:   Unreviewed

Organism:   Solanum tuberosum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.

Sequence Information back to top


Sequence length:   300

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|M1D7G9|M1D7G9_SOLTU|Unreviewed|Solanum_tuberosum|300
MAVDFGHYAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIY
YALLKSNMPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVT
EFLFKGVVRGQIVGWVCLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWF
FYGLLLKDINIAAPNVLGFIFGILQIILYAIYSKKEKSIIKEQKLPEMQKPEVIVKDENM
NANKKLPELTQEQIIDIVKLAGLLVVTDKANVATCPNDTNCGVKAAIKIENMPKLQTVAT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   214

Alignment file: M1D7G9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M1D7G9_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.6% favored    4.3% allowed    .0% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M1D7G9_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    5.4% allowed    1.6% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M1D7G9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    4.8% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   102598354     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur