| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M1CBD6
dbSWEET id: dbswt_752
Accession: M1CBD6
Uniprot status: Unreviewed
Organism: Solanum tuberosum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.
Sequence Information back to top
Sequence length: 253
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMC CVV: 430 CHI: 4.7
Fasta sequence:
>tr|M1CBD6|M1CBD6_SOLTU|Unreviewed|Solanum_tuberosum|253
MGVVHTLHFVFGIFGNATALFLFLAPIITFKRVIQNRSTEQFSGLPYVMTLLNCLLSAWY
GLPFVSPNNLLVSTINGTGAVIETIYVLIFIAFAPSKEKKKISALLLLVLTVFAAVALVS
MLALHGSKRKLFCGIAATIFSIIMYGSPLSIIRLVIKTKSVEFMPFFLSLFVFLCGASWF
AFGLLGKDPFVAIPNGFGFGLGTVQLILYAIYCEKKGFTKKSTFDESLTTGNVKSHQEEK
QSSNNNKSKLEQV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 214
Alignment file: M1CBD6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M1CBD6_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.1% favored 3.2% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M1CBD6_outward.pdb
Procheck score ⇒ Ramachandran plot: 96.8% favored 2.2% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M1CBD6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.4% favored 7.0% allowed .0% week .5% disallowed
Gene Informationback to top
Gene ID: 102600613 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA