Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M1CBD4

dbSWEET id: dbswt_745

Accession:   M1CBD4

Uniprot status:   Unreviewed

Organism:   Solanum tuberosum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.

Sequence Information back to top


Sequence length:   250

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMC           CVV:   430       CHI:   4.7

Fasta sequence:

>tr|M1CBD4|M1CBD4_SOLTU|Unreviewed|Solanum_tuberosum|250
MAIIKILHTLFGIFGNITGLFLFLAPMITFKRVIMHKSTEQFSGIPYVMTLLNCLLSTWY
GLPFVSPNNMLVSIINGTGAGLEAFYVLVFLIFAPKKEKAKISGILCVVLSIFSTVALVS
MLALHGNKRKVFSGFAAAIFSIIMYGSPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWF
VYGLLGKDPFIAVPNGVGSFLGTAQLILYAIYRENKGQIKKGEEDGRVEMELEKPYEKEI
PNTQSGDAKV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   214

Alignment file: M1CBD4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M1CBD4_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    4.3% allowed    1.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M1CBD4_outward.pdb

Procheck score ⇒ Ramachandran plot: 96.2% favored    2.7% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M1CBD4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 95.1% favored    3.8% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur