Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M1CB32

dbSWEET id: dbswt_464

Accession:   M1CB32

Uniprot status:   Unreviewed

Organism:   Solanum tuberosum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.

Sequence Information back to top


Sequence length:   291

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   MSMN           CVV:   417       CHI:   -0.5

Fasta sequence:

>tr|M1CB32|M1CB32_SOLTU|Unreviewed|Solanum_tuberosum|291
MANFSFILGIIGNVISILMFAAPIKTFKRIMKKKSTEDFKGIPYITTLLSTCLWTFYGLL
KPGGLLVVTVNGTGAIFHIIYVTLFLIYAPKPLKIQSMKLVAIINIAFLGAVIAITLLAV
HGTTRLTLVGFLCAALNIGMYAAPLAATRTVIKMKSVEYMPFFLSFFQFLNGGVWTAYAV
LVKDYFIGVPNGIGFILGAAQLILYFMYYKSSPTEEKGSAHLMKREIQMKDVNGAHENEN
NRNLLHKGKSLPKPSLVRQYSERLVKTLSNTPSSLGSHNVNDIEKGLKEAH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: M1CB32.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M1CB32_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.6% favored    2.8% allowed    1.1% week    .6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M1CB32_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.5% favored    3.9% allowed    1.7% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M1CB32_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.4% favored    5.5% allowed    .6% week    .6% disallowed

Gene Informationback to top


Gene ID:   102584909     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur