| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M1CB29
dbSWEET id: dbswt_491
Accession: M1CB29
Uniprot status: Unreviewed
Organism: Solanum tuberosum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.
Sequence Information back to top
Sequence length: 237
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: MNMN CVV: 440 CHI: -3.2
Fasta sequence:
>tr|M1CB29|M1CB29_SOLTU|Unreviewed|Solanum_tuberosum|237
METLPFIIGIIGNIISVLMFLAPVGTFRRIVQNKSTEDFDSLPYICTLLNSSLWTYYGII
KPGSYLVSTVNGFGVIVETIYIALFLKFADKKMRKNTGILAGILNVGILATILLLAQFIL
YGEMRINIIGFLSTCLNIIMYSSPLGVMKTVVRSKSVEFMPFLLSFFFFLNGGVWTLYAL
LVSDWFLGVPNGIGWFLGAVQLVIYVIYRSPNSSVEDLEQGDQTERLLPPSSTPTLQ
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: M1CB29.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M1CB29_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.6% favored 2.2% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M1CB29_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.0% favored 3.3% allowed .6% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M1CB29_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.2% favored 7.2% allowed 1.1% week .6% disallowed
Gene Informationback to top
Gene ID: 102584588 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA