| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M1B2X7
dbSWEET id: dbswt_698
Accession: M1B2X7
Uniprot status: Unreviewed
Organism: Solanum tuberosum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.
Sequence Information back to top
Sequence length: 256
Substrate Binding Site: CNWT CVV: 438 CHI: -2.6
Selectivity Filter: LNMS CVV: 417 CHI: 1.4
Fasta sequence:
>tr|M1B2X7|M1B2X7_SOLTU|Unreviewed|Solanum_tuberosum|256
MGGLVQTIKFVFGIVGNAATLFLFLVPTFTFKRIIENKSTEQFSGIPYVMTFLNCLLSAW
YGLPFITSNNILIATVNGAGAAIELIYVLIFFLYAPNKQKGKILAMLILVILAFAAAAVI
SVLAFHGKNRQLFCGTAATIFSIVMYASPMSIIRLVIKTKSVEYMPFFLSFAVVVSCSCW
FTYAMLGMDPFVGISTGVGLALGIVQLILYFIYCDKKILNKKTTATDESLQNMGNGYSNN
VKCYNDEKQSNFHEQV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 215
Alignment file: M1B2X7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M1B2X7_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.8% favored 3.2% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M1B2X7_outward.pdb
Procheck score ⇒ Ramachandran plot: 96.3% favored 3.2% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M1B2X7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 4.8% allowed .0% week .5% disallowed
Gene Informationback to top
Gene ID: 102599149 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA