| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M0Z8N0
dbSWEET id: dbswt_527
Accession: M0Z8N0
Uniprot status: Unreviewed
Organism: Hordeum vulgare
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Hordeinae ⇒ Hordeum.
Sequence Information back to top
Sequence length: 248
Substrate Binding Site: SSWS CVV: 382 CHI: -3.3
Selectivity Filter: LSMT CVV: 414 CHI: 4.2
Fasta sequence:
>tr|M0Z8N0|M0Z8N0_HORVD|Unreviewed|Hordeum_vulgare|248
MFPDMHVTTGIIGSVVCFLLYAAPILTFKRVIKKGSVEEYSCIPYILTLFSSLTYTWYGL
PVVSSGWENWTLSGISSLGVLFESTFIGIYIWFAPREKKKLVMMMVSPILIIFGMAVFFT
SFSFHTHQMRKEFVGSIGLVASILMYGSPLVAVKQVIRTKSVEFMPFYLSLFSFLTSLLW
MLYGLLGKDPFLTAPSFIGCLMGILQLVVYCIYSKCKEAPKTNPDIEQADELKVVTIQDN
TKGQKAII
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: M0Z8N0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M0Z8N0_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.3% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M0Z8N0_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.3% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M0Z8N0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 5.9% allowed 1.1% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA