Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M0UMW1

dbSWEET id: dbswt_55

Accession:   M0UMW1

Uniprot status:   Unreviewed

Organism:   Hordeum vulgare

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Hordeinae ⇒ Hordeum.

Sequence Information back to top


Sequence length:   287

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|M0UMW1|M0UMW1_HORVD|Unreviewed|Hordeum_vulgare|287
MAGGLFSMAHPWASAFGILGNIISFLVFLAPTPTFLRVYRKKSTEGFSSVPYVVALFSCT
LWILYALVKTNSSPLLTINAFGCVVEAFYIVLYLVYAPRPARMRALAFFLLLNVAAFSLI
VAVTVFLVPQPSRVKVLGSVCLAFSMAVFVAPLTVIFVVIKTKSAEYMPFSLSFFLTLSA
VAWFFYGLFTKDIYVTLPNVGGFFFGVAQMTLYFCYRKPDTSALVLPTGIHDVSTEAAAQ
QEVELPEGTHPAVAMLTVSTLPMLAELQKMEQEISSPTPRKGYIKAF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   6     Model end:   218

Alignment file: M0UMW1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M0UMW1_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    5.3% allowed    2.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M0UMW1_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    6.9% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M0UMW1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.3% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur