| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M0U171
dbSWEET id: dbswt_307
Accession: M0U171
Uniprot status: Unreviewed
Organism: Musa acuminata
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Zingiberales ⇒ Musaceae ⇒ Musa.
Sequence Information back to top
Sequence length: 274
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSCS CVV: 337 CHI: 5.1
Fasta sequence:
>tr|M0U171|M0U171_MUSAM|Unreviewed|Musa_acuminata|274
MSIEMNFESIEMRLVSMFGDISFICNGFFCFLPCAGNILSFLVVLAPMPTFYKIYKKKST
EEFGSVPYMVGLFSAMMWIYYGALTMDFLLLSINVGASLIETAYLILFLIYAPAKPRAFT
LKLVSLFNVGAYGSVVLFTMLFLRGGRRTNIAGWICASFAFSCFVAPLSIIKQVIRTKSV
EYMPISLSFFLTVSAIAWLSYGLLLGDLHVALPNVVGFLFGVAQIIIYLVYKNAKKDDTK
TKLGNQPAEAMATAVTSGSDIELPEKLSTPQAEV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 22 Model end: 233
Alignment file: M0U171.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M0U171_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.1% favored 2.7% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M0U171_outward.pdb
Procheck score ⇒ Ramachandran plot: 96.2% favored 3.2% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M0U171_occluded.pdb
Procheck score ⇒ Ramachandran plot: 95.1% favored 4.3% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22