Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M0TTF4

dbSWEET id: dbswt_821

Accession:   M0TTF4

Uniprot status:   Unreviewed

Organism:   Musa acuminata

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Zingiberales ⇒ Musaceae ⇒ Musa.

Sequence Information back to top


Sequence length:   252

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMN           CVV:   440       CHI:   -1.3

Fasta sequence:

>tr|M0TTF4|M0TTF4_MUSAM|Unreviewed|Musa_acuminata|252
MVVSADTFRTVVGIIGNGTALVLFLSPAPTFHRIWRSGSVEQFHATPYLATLLNCLFWIL
YGLPMVHPHSTLILTINGSGLVIELVYVLIFLRCSDGARKLRVFSVLLAEILLVGAVAAV
DLTLVHGYQRRSLIVGVLCVVFGTVMYAAPLSVMQQVIKTKSVEFMPLSLSLASFLNGVC
WTTYALIRFDLFITIPNGLGVAFAVAQLVLHMMYHASTKQQIKERKMKIEMGLAKPNGSL
KEDLEAGSRNGS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   216

Alignment file: M0TTF4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M0TTF4_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.3% allowed    1.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M0TTF4_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    6.9% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M0TTF4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.9% favored    5.8% allowed    2.1% week    2.1% disallowed

Gene Informationback to top


Gene ID:   103996312     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur