Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M0THK6

dbSWEET id: dbswt_819

Accession:   M0THK6

Uniprot status:   Unreviewed

Organism:   Musa acuminata

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Zingiberales ⇒ Musaceae ⇒ Musa.

Sequence Information back to top


Sequence length:   262

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMN           CVV:   440       CHI:   -1.3

Fasta sequence:

>tr|M0THK6|M0THK6_MUSAM|Unreviewed|Musa_acuminata|262
MVSADAIRTAVGILGNAIALGLFLSPVPTFVKIWKKGSVQEFSPIPYVATLLNCMMWVVY
GLPMVHPHSMLVITINGSGLVIELSYVLLFIVYSSGGKRLKVLVMLLAETAFVGVVALLV
LTLAHTHERRSMIVGVLCVFFGTMMYAAPLSVMKMVIRSKSVEYMPLSLSLASFFNGVCW
TAYALIRFDPYITIPNGLGVMFAVAQLVLYAMYYKSTQRQVEAKKRKAELGLTEVVVVKG
DANKIVSVPINGGGSNAENRDM

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: M0THK6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M0THK6_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.3% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M0THK6_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    8.0% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M0THK6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    3.2% allowed    1.1% week    1.1% disallowed

Gene Informationback to top


Gene ID:   103991676     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur