Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : M0T9N3
dbSWEET id: dbswt_388
Accession: M0T9N3
Uniprot status: Unreviewed
Organism: Musa acuminata
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Zingiberales ⇒ Musaceae ⇒ Musa.
Sequence Information back to top
Sequence length: 275
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|M0T9N3|M0T9N3_MUSAM|Unreviewed|Musa_acuminata|275
MAAGLSLDRPWAFTFGILGNIISFMVYLAPLPTFYRVYKRKSTEGFQSVPYVVALFSAML
WISYAFLKTDACLLITINSVGCAIETVYIVYAPKATKIFTAKLVLLVIVAMFGLILLLTL
LLSEGAKRVEILGWICVSFSVSVFVAPLSVIRLVIRTKSVEFMPFSLSFFLTLSAVVWFA
YGLLIRDLYVSLPNVLGFIFGILQMALYVAYKDRKKAAVVEQEPPEHVLPITNRDTAQKA
VEVHRTVETHGEDKVGDGDQKEIDENKEVMASVEV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 213
Alignment file: M0T9N3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M0T9N3_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 6.4% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M0T9N3_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 6.9% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M0T9N3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.4% favored 7.4% allowed 2.1% week .0% disallowed
Gene Informationback to top
Gene ID: 103988975 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22