Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M0T544

dbSWEET id: dbswt_389

Accession:   M0T544

Uniprot status:   Unreviewed

Organism:   Musa acuminata

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Zingiberales ⇒ Musaceae ⇒ Musa.

Sequence Information back to top


Sequence length:   288

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|M0T544|M0T544_MUSAM|Unreviewed|Musa_acuminata|288
MAGLSLDHPWAFTFGILGNIISFMVYLAPLPTFYRVYRGKSTEGFQSVPYVVALFSAMLW
VLYAFLKTDAFLLITINSFGCVIESVYVVLYFTYAPKLAKILTAKLVLVLNVGMFGSILL
LTLLLPDGLKRVRVLGWICMCFSVSVFVAPLSIIRLVIRTKSVEFMPFMLSFFLTLSSIV
WFAYGCLTKDKFVALPNVLGFAFGLLQMGLYLAFKCMKPTAVEPRLPEHIISISMLGVEV
YPIDWKTPEVNDEEKAENGDRKEADTGEEKVEGMAAPHEENEVNHVDV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   216

Alignment file: M0T544.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M0T544_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    4.8% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M0T544_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    4.8% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M0T544_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    6.4% allowed    .5% week    .0% disallowed

Gene Informationback to top


Gene ID:   103987256     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur