Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M0SD13

dbSWEET id: dbswt_308

Accession:   M0SD13

Uniprot status:   Unreviewed

Organism:   Musa acuminata

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Zingiberales ⇒ Musaceae ⇒ Musa.

Sequence Information back to top


Sequence length:   261

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|M0SD13|M0SD13_MUSAM|Unreviewed|Musa_acuminata|261
MRKGMTFFFCFCSPSTGNIISFLVVLAPVPTFYRIYKKKSTESFDSVPYVVALFSAMLWV
FYGLLTLDVLLLTINTGACIIEMIYLTIYLIYASKKPRAFTLKLISLVNVGIYGSLVLFT
TLFVKGKRRIDVTGWICASFAVSVFAAPLSIIRLVIRTKSVEYMPFSLSFFLTLSAVAWF
SYGILLGDLFVALPNVVGFMFGIAQIIIYFMYVNSKKAETKPKLNAEAMPAAATLDSVVE
LPEKKGVPQPVVCEFTSVIEV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   214

Alignment file: M0SD13.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M0SD13_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.0% favored    6.3% allowed    1.1% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M0SD13_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    4.8% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M0SD13_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    6.3% allowed    .5% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur