Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : L8K892

dbSWEET id: dbswt_1858

Accession:   L8K892

Uniprot status:   Unreviewed

Organism:   Elizabethkingia anophelis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Elizabethkingia.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|L8K892|L8K892_9FLAO|Unreviewed|Elizabethkingia anophelis|86
MKNKLNTIIXSIGAAIGIFVFLAYIPQIIANLEGIKGQPWQPLIAAISCFTWVIYGWTSQ
PKRDXILIIPNIFGVILGTMTFVTSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  L8K892_inward.pdb    Alignment file: L8K892_inw.pir

Procheck score ⇒ Ramachandran plot: 92.6% favored    4.1% allowed    3.3% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  L8K892_outward.pdb    Alignment file: L8K892_out.pir

Procheck score ⇒ Ramachandran plot: 88.5% favored    9.0% allowed    1.6% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  L8K892_occluded.pdb    Alignment file: L8K892_occ.pir

Procheck score ⇒ Ramachandran plot: 93.5% favored    5.6% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur