Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : L8K892
dbSWEET id: dbswt_1858
Accession: L8K892
Uniprot status: Unreviewed
Organism: Elizabethkingia anophelis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Elizabethkingia.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|L8K892|L8K892_9FLAO|Unreviewed|Elizabethkingia anophelis|86
MKNKLNTIIXSIGAAIGIFVFLAYIPQIIANLEGIKGQPWQPLIAAISCFTWVIYGWTSQ
PKRDXILIIPNIFGVILGTMTFVTSL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: L8K892_inward.pdb Alignment file: L8K892_inw.pir Procheck score ⇒ Ramachandran plot: 92.6% favored 4.1% allowed 3.3% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: L8K892_outward.pdb Alignment file: L8K892_out.pir Procheck score ⇒ Ramachandran plot: 88.5% favored 9.0% allowed 1.6% week .8% disallowed Occluded: Model structure: L8K892_occluded.pdb Alignment file: L8K892_occ.pir Procheck score ⇒ Ramachandran plot: 93.5% favored 5.6% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA