Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : L5JWD6

dbSWEET id: dbswt_1208

Accession:   L5JWD6

Uniprot status:   Unreviewed

Organism:   Pteropus alecto

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Laurasiatheria ⇒ Chiroptera ⇒ Megachiroptera ⇒ Pteropodidae ⇒ Pteropodinae ⇒ Pteropus.

Sequence Information back to top


Sequence length:   221

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMT           CVV:   437       CHI:   -0.4

Fasta sequence:

>tr|L5JWD6|L5JWD6_PTEAL|Unreviewed|Pteropus_alecto|221
MDAGGVADALLSGACVLFTLGMFSTGLSDLRHMRMTRRVDNVQFLPFLTTDVNNLSWLSY
GTLKGDGTLIVVNAVGAVLQTLYISAYLHYCPRKHAVLLQTAALLGVLLLGFGYFWFLVP
NTEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQRLSFSLTIATLLTSASWTLYGF
RLRDPYIMVPNLPGIFTSLIRLWLFWKYPQEQDRNYQLLQT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: L5JWD6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  L5JWD6_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    4.3% allowed    2.7% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  L5JWD6_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.4% favored    7.0% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  L5JWD6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.7% favored    9.2% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   102891328     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur