Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : L1Q0A2

dbSWEET id: dbswt_1857

Accession:   L1Q0A2

Uniprot status:   Unreviewed

Organism:   Capnocytophaga

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Capnocytophaga.

Sequence Information back to top


Sequence length:   108

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|L1Q0A2|L1Q0A2_9FLAO|Unreviewed|Capnocytophaga| 108
MILLCEIIIFAEKYFFMKEKRNVKQKINLFIGSIGAFIGVMVFIAYIPQIIANLEGHKAQ
PWQPLFAAGSCLIWVVYGWTKEPKPDYILIIPNFVGVVLGFLTFITSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   32     Model end:   109

Inward Open:

Template:   4X5M.pdb

Model structure:  L1Q0A2_inward.pdb    Alignment file: L1Q0A2_inw.pir

Procheck score ⇒ Ramachandran plot: 87.9% favored    11.3% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  L1Q0A2_outward.pdb    Alignment file: L1Q0A2_out.pir

Procheck score ⇒ Ramachandran plot: 89.5% favored    7.3% allowed    .8% week    2.4% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  L1Q0A2_occluded.pdb    Alignment file: L1Q0A2_occ.pir

Procheck score ⇒ Ramachandran plot: 87.9% favored    10.5% allowed    .0% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur