Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : L1PFH6
dbSWEET id: dbswt_1856
Accession: L1PFH6
Uniprot status: Unreviewed
Organism: Actinomyces
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CPCP CVV: 352 CHI: 1.8
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|L1PFH6|L1PFH6_9ACTO|Unreviewed|Actinomyces|87
MSKQKINRFVGSIGAFIGILVFIAYIPQIIANLQGEKAQPFQPLFAAFSCLIWVIYGWTK
EPKKDWILIIPNAAGVILGGLTFITSL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: L1PFH6_inward.pdb Alignment file: L1PFH6_inw.pir Procheck score ⇒ Ramachandran plot: 89.5% favored 7.3% allowed 1.6% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: L1PFH6_outward.pdb Alignment file: L1PFH6_out.pir Procheck score ⇒ Ramachandran plot: 91.9% favored 6.5% allowed .8% week .8% disallowed Occluded: Model structure: L1PFH6_occluded.pdb Alignment file: L1PFH6_occ.pir Procheck score ⇒ Ramachandran plot: 85.5% favored 12.1% allowed 1.6% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA