Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : L1P035
dbSWEET id: dbswt_1854
Accession: L1P035
Uniprot status: Unreviewed
Organism: Capnocytophaga
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Capnocytophaga.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|L1P035|L1P035_9FLAO|Unreviewed|Capnocytophaga|87
MENNKFFTVLSYAAAIMAVGMYVSYIPQIADNLAGHKGNPIQPLVAAINCTLWVAYGLLK
KPKRDMPIIFANAPGIIFGLIAFLTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: L1P035_inward.pdb Alignment file: L1P035_inw.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 4.8% allowed .8% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: L1P035_outward.pdb Alignment file: L1P035_out.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.9% allowed .0% week .0% disallowed Occluded: Model structure: L1P035_occluded.pdb Alignment file: L1P035_occ.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 5.6% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA