Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : L1NVE3

dbSWEET id: dbswt_1852

Accession:   L1NVE3

Uniprot status:   Unreviewed

Organism:   Neisseria

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Neisseriales ⇒ Neisseriaceae ⇒ Neisseria.

Sequence Information back to top


Sequence length:   119

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ANAN           CVV:   326       CHI:   -3.4

Fasta sequence:

>tr|L1NVE3|L1NVE3_9NEIS|Unreviewed|Neisseria| 119
MMPRFFAAWAAAEQASAKGFCAPHKHFDRKIMNEKQIRILGTIGSIMAVGMYVAYIPQIQ
ANLAGREVGFMELLQPLVACINCTIWVAYGLFKQPRDWPIAVANAPGIVLGLLTFITGL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   41     Model end:   120

Inward Open:

Template:   4X5M.pdb

Model structure:  L1NVE3_inward.pdb    Alignment file: L1NVE3_inw.pir

Procheck score ⇒ Ramachandran plot: 88.3% favored    10.2% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  L1NVE3_outward.pdb    Alignment file: L1NVE3_out.pir

Procheck score ⇒ Ramachandran plot: 92.2% favored    7.8% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  L1NVE3_occluded.pdb    Alignment file: L1NVE3_occ.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    4.7% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur