Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : L1NGF3

dbSWEET id: dbswt_1850

Accession:   L1NGF3

Uniprot status:   Unreviewed

Organism:   Prevotella saccharolytica

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   FNFN           CVV:   462       CHI:   -1.4

Fasta sequence:

>tr|L1NGF3|L1NGF3_9BACT|Unreviewed|Prevotella saccharolytica|86
MEKQKFFETMGWVGIVTAILMYVFYFPQIQGNLEGHKGSFIQPFMAGINCTLWVSYALFK
EHRDWPVAIANAPGVVFGFIAAFTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  L1NGF3_inward.pdb    Alignment file: L1NGF3_inw.pir

Procheck score ⇒ Ramachandran plot: 90.5% favored    7.1% allowed    .8% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  L1NGF3_outward.pdb    Alignment file: L1NGF3_out.pir

Procheck score ⇒ Ramachandran plot: 88.9% favored    9.5% allowed    .8% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  L1NGF3_occluded.pdb    Alignment file: L1NGF3_occ.pir

Procheck score ⇒ Ramachandran plot: 89.7% favored    9.5% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur