Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : K8W659

dbSWEET id: dbswt_1849

Accession:   K8W659

Uniprot status:   Unreviewed

Organism:   Providencia burhodogranariea

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Enterobacterales ⇒ Morganellaceae ⇒ Providencia.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|K8W659|K8W659_9GAMM|Unreviewed|Providencia burhodogranariea|87
MTTETVPKYISYLGWIATITAFSMYVSYIPQIMGNLDGNKTHPLQAAVACINCTLWVWYG
IKLNNKPVAIANAPGVVFGLIAFVTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   14     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  K8W659_inward.pdb    Alignment file: K8W659_inw.pir

Procheck score ⇒ Ramachandran plot: 94.4% favored    5.6% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  K8W659_outward.pdb    Alignment file: K8W659_out.pir

Procheck score ⇒ Ramachandran plot: 92.9% favored    7.1% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  K8W659_occluded.pdb    Alignment file: K8W659_occ.pir

Procheck score ⇒ Ramachandran plot: 96.8% favored    3.2% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur