Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : K8W659
dbSWEET id: dbswt_1849
Accession: K8W659
Uniprot status: Unreviewed
Organism: Providencia burhodogranariea
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Enterobacterales ⇒ Morganellaceae ⇒ Providencia.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|K8W659|K8W659_9GAMM|Unreviewed|Providencia burhodogranariea|87
MTTETVPKYISYLGWIATITAFSMYVSYIPQIMGNLDGNKTHPLQAAVACINCTLWVWYG
IKLNNKPVAIANAPGVVFGLIAFVTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 14 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: K8W659_inward.pdb Alignment file: K8W659_inw.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 5.6% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: K8W659_outward.pdb Alignment file: K8W659_out.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 7.1% allowed .0% week .0% disallowed Occluded: Model structure: K8W659_occluded.pdb Alignment file: K8W659_occ.pir Procheck score ⇒ Ramachandran plot: 96.8% favored 3.2% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA