Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : K8MZS7
dbSWEET id: dbswt_1848
Accession: K8MZS7
Uniprot status: Unreviewed
Organism: Streptococcus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|K8MZS7|K8MZS7_9STRE|Unreviewed|Streptococcus|87
MTKQKINRIVGSIGAFIGIIVFIAYIPQIFANLQGNKAQPFQPLSAAVSCLIWVIYGWTK
EPKKDWILIIPNSAGVVLGGLTFLTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: K8MZS7_inward.pdb Alignment file: K8MZS7_inw.pir Procheck score ⇒ Ramachandran plot: 88.1% favored 11.1% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: K8MZS7_outward.pdb Alignment file: K8MZS7_out.pir Procheck score ⇒ Ramachandran plot: 86.5% favored 11.1% allowed 1.6% week .8% disallowed Occluded: Model structure: K8MZS7_occluded.pdb Alignment file: K8MZS7_occ.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 6.3% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA