Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : K7VDX6

dbSWEET id: dbswt_326

Accession:   K7VDX6

Uniprot status:   Unreviewed

Organism:   Zea mays

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Andropogonodae ⇒ Andropogoneae ⇒ Tripsacinae ⇒ Zea.

Sequence Information back to top


Sequence length:   305

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|K7VDX6|K7VDX6_MAIZE|Unreviewed|Zea_mays|305
MITVGHPVAFAVGILGNILSFLVILAPVPTFYRVYAKKSTESFQSVPYVVALLSATLWLY
YALLSTDLLLLSINTVACVAESVYLAVYLAYAPGPAKAFTLKLLCAINMGLFGAMVAFLQ
FYVVDTQRRVSIAGGVGAAFALAVFVAPLAIIRRVMRTKSVEFMPFWLSFFLTVSAVVWF
FYGLLIKDFFVAMPNVLGLLFGLAQMVLFFVYRNRNPKKNGAVSEMQQAAVQADAEKERR
SHANADGEADVRTVIVDIMPPPPAMMRHADREARGGAGTGRRAAAREQGGARRREDREAL
GGGGI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   214

Alignment file: K7VDX6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  K7VDX6_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    3.7% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  K7VDX6_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    5.3% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  K7VDX6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    5.8% allowed    2.1% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur