Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : K7KG83

dbSWEET id: dbswt_271

Accession:   K7KG83

Uniprot status:   Unreviewed

Organism:   Glycine max

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Glycine ⇒ Soja.

Sequence Information back to top


Sequence length:   336

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   ITVS           CVV:   395       CHI:   7.2

Fasta sequence:

>tr|K7KG83|K7KG83_SOYBN|Unreviewed|Glycine_max|336
ISSEIYLLLSLSQFILHQEVMETHHDVFVLVFGVLGNIVNSLIYLAPMVTIYDTFQEQTK
QHYNAIPYSLSLFTASLMLYYAHLKGNEEALLLITINSIGCTMEVAYLIICYIYANFRAK
TVIVRWVFLFNGATYLVILFLTSLVSPLSNRLKVVGWICATFSVGVYVTSLINPMMRTVV
RTKCISMPLLISLTLSSIVWFFYGFFSHDYFIVMPNVLHFWLGVAQMILCFIYRNGGADE
RERVQSETGEINNENDEILETIEMQIAEAKNTNVDHQTDNDDIKKKENGSSSRVELEPCE
IVHLQNNIVVVTRNGTRIVCNEIQSVAEPEIVEIPG

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   22     Model end:   235

Alignment file: K7KG83.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  K7KG83_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    5.6% allowed    1.0% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  K7KG83_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.1% allowed    1.5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  K7KG83_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    7.7% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur