Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : K6TTJ9

dbSWEET id: dbswt_2081

Accession:   K6TTJ9

Uniprot status:   Unreviewed

Organism:   Methanobacterium

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Euryarchaeota ⇒ Methanobacteria ⇒ Methanobacteriales ⇒ Methanobacteriaceae ⇒ Methanobacterium.

Sequence Information back to top


Sequence length:   89

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|K6TTJ9|K6TTJ9_9EURY|Unreviewed|Methanobacterium|89
MINISIETIGLLASLTAIIMFISPIAQIQSIRKIKKSDEVSPALYIAMVVNCSLWTIYGA
GIENWYILTPNAIGAVLGILTLTVIYRYR

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  K6TTJ9_inward.pdb    Alignment file: K6TTJ9_inw.pir

Procheck score ⇒ Ramachandran plot: 93.4% favored    4.4% allowed    2.2% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  K6TTJ9_outward.pdb    Alignment file: K6TTJ9_out.pir

Procheck score ⇒ Ramachandran plot: 94.1% favored    5.1% allowed    .0% week    .7% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  K6TTJ9_occluded.pdb    Alignment file: K6TTJ9_occ.pir

Procheck score ⇒ Ramachandran plot: 90.4% favored    8.8% allowed    .0% week    .7% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur