| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : K4BZR4
dbSWEET id: dbswt_151
Accession: K4BZR4
Uniprot status: Unreviewed
Organism: Solanum lycopersicum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum ⇒ Lycopersicon.
Sequence Information back to top
Sequence length: 295
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|K4BZR4|K4BZR4_SOLLC|Unreviewed|Solanum_lycopersicum|295
MALFDLHHPWLFVFGVLGNVISILVFLAPVPAFRRICKEKSTMGYQSVPYVVALFSSMLW
MYYAFIKKNAILLVSINSFGCIVETIYITIFILYASKEARRQTVQLLVLLIGGLYTLIFL
ITLFPLNGVLRVQVVGWICVTVAVGVFAAPLSIVFQVVRTRTVEFMPFTLSFFLTLSAIM
WFGYGLLLKDLCIALPNVLGFFLGMIQMLLYGIYRNAKPAIDLEKKVCEHAVNSEQIYPV
DSEDVNFNDTEEINMAAIVPVVVANNNENEERLGDDVAQVKLQPFQTPVLVVCAA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 216
Alignment file: K4BZR4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: K4BZR4_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 2.7% allowed 2.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: K4BZR4_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 4.8% allowed .5% week 1.6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: K4BZR4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.8% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 101255592 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005887 - integral component of plasma membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
GO:0071470 - cellular response to osmotic stress
GO:0010150 - leaf senescence
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA