Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : K4BT53

dbSWEET id: dbswt_746

Accession:   K4BT53

Uniprot status:   Unreviewed

Organism:   Solanum lycopersicum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum ⇒ Lycopersicon.

Sequence Information back to top


Sequence length:   245

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMC           CVV:   430       CHI:   4.7

Fasta sequence:

>tr|K4BT53|K4BT53_SOLLC|Unreviewed|Solanum_lycopersicum|245
MAIIKILHTLFGIFGNITGLFLFLAPMITFKRVIMNKSTEQFSGIPYVMTLLNCLLSTWY
GLPFVSPNNMLVSIINGTGAGLEAFYVLVFLIFAPKKEKAKISGILFVVLSIFSTVALVS
MLALHDNKRKVFSGFAAAIFSIIMYGSPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWF
VYGLLGKDPFIAVPNGVGSLLGTAQLILYAIYRGEKGQSKKGEEDGRVEMELEKPSNTQN
GDAKA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   214

Alignment file: K4BT53.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  K4BT53_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    4.3% allowed    1.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  K4BT53_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.7% favored    3.2% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  K4BT53_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.6% favored    5.4% allowed    .0% week    .0% disallowed

Gene Informationback to top


Gene ID:   101259239     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur