| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : K4BKS2
dbSWEET id: dbswt_892
Accession: K4BKS2
Uniprot status: Unreviewed
Organism: Solanum lycopersicum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum ⇒ Lycopersicon.
Sequence Information back to top
Sequence length: 236
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|K4BKS2|K4BKS2_SOLLC|Unreviewed|Solanum_lycopersicum|236
MNTHTIRTIVGIIGNVISFFLFLSPMPTFIKIWKAKTVMQFKPDPYVVTALNCAVWVFYG
MPFVHPDSLLVVTINGIGLFIEFLYIIVFYIYSDGPKRKKISIFLGVEIILFAILVFVTL
TFLHGTKKRSMLVGILAVIMNVAMYASPLTVMRRVISTKSVKFMPFYLSLANFCNGGIWF
AYAFLKFDPYILIPNGLGTLSGAIQLILYAKYYKTTNWDDEEKPNEVELQRNSDTV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 214
Alignment file: K4BKS2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: K4BKS2_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.8% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: K4BKS2_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.3% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: K4BKS2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 5.9% allowed .5% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA