Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : K4BJH6
dbSWEET id: dbswt_228
Accession: K4BJH6
Uniprot status: Unreviewed
Organism: Solanum lycopersicum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum ⇒ Lycopersicon.
Sequence Information back to top
Sequence length: 298
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|K4BJH6|K4BJH6_SOLLC|Unreviewed|Solanum_lycopersicum|298
MVFNHWAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYA
LLKSNMPLLITINSFGMFIETIYVGLYLLYAPNKARVHTIKMLMLSVVGGFGAIVLITEF
LFKGVVRGQIVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFY
GLLLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKVILKEQKLPEIQTPAVIVKNENMMN
TTKKLPELTQEQIIDIVKLGLLVCSDKTQVATCPNDTNCGVKDTNNNVVNMPKLQTVA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 212
Alignment file: K4BJH6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: K4BJH6_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 3.8% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: K4BJH6_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 5.9% allowed 1.1% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: K4BJH6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 7.0% allowed 1.1% week .5% disallowed
Gene Informationback to top
Gene ID: 101263500 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA