Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : K4BJH5

dbSWEET id: dbswt_224

Accession:   K4BJH5

Uniprot status:   Unreviewed

Organism:   Solanum lycopersicum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum ⇒ Lycopersicon.

Sequence Information back to top


Sequence length:   302

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|K4BJH5|K4BJH5_SOLLC|Unreviewed|Solanum_lycopersicum|302
MAGISGHWAFAFGILGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIY
YALLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLMLSVVGGFGAIVLVT
EFLFKGVVRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSIFLTLSAVVWF
FYGLLLKDINIAAPNVLGFIFGILQIVLYVIYNKKEKVILKEQKLPEIQKAAVIVSDDNT
NVNKKLPELTQEQIIDIVRLAGLLANTDKVQVATCPHDHANCGVKATPNVENMPKLQTVE
AS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   214

Alignment file: K4BJH5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  K4BJH5_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    5.4% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  K4BJH5_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.6% favored    3.8% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  K4BJH5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    5.9% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur