Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : K4BBJ9

dbSWEET id: dbswt_869

Accession:   K4BBJ9

Uniprot status:   Unreviewed

Organism:   Solanum lycopersicum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum ⇒ Lycopersicon.

Sequence Information back to top


Sequence length:   233

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMN           CVV:   440       CHI:   -1.3

Fasta sequence:

>tr|K4BBJ9|K4BBJ9_SOLLC|Unreviewed|Solanum_lycopersicum|233
MVMSTNDIRFIVGIIGNVLSFVLFASPMPTFRRIIKNKSVEEFHPYPYLASTMNCLMWIY
YGMPFVHPHSILVVTINSVGLFMQLCYISIFFFYTGKRYRLQIVSILFGEVVGLAAAVAG
TMLGLHTYASRTTVVGILATAFGICMYGSPLSIMYKVIKTKSAEFLPKTLSIACFLNGIC
WAIYALLKFDPYILTGNGVGALLALIQLALIVIYRNPPPKDQKPSKVELQNVV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   216

Alignment file: K4BBJ9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  K4BBJ9_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.6% favored    5.9% allowed    .0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  K4BBJ9_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.2% favored    3.7% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  K4BBJ9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.3% favored    9.1% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Gene ID:   101251355     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

GO:0010208 - pollen wall assembly

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur