| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : K4AJ76
dbSWEET id: dbswt_327
Accession: K4AJ76
Uniprot status: Unreviewed
Organism: Setaria italica
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Panicodae ⇒ Paniceae ⇒ Cenchrinae ⇒ Setaria.
Sequence Information back to top
Sequence length: 303
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|K4AJ76|K4AJ76_SETIT|Unreviewed|Setaria_italica|303
MITVGHPLVFAVGILGNILSFLVTLAPVPTFYRVYKKKSTESFQSVPYVVALLSAMLWLY
YALLSMDVLLLSINAIACVVESVYLAIYLVYAPRNAMVFTAKLLCIMNMGLFGAMVAFLQ
FFVEGRRRVSIAGGVGAAFALAVFVAPLAIIRQVIRTKSVEFMPVWLSFFLTISAVVWFF
YGLLMKDFFVAMPNVLGLLFGLAQMALYFVYRNPKKNGAVSEMQQVVAQAADAAEKEQQQ
QAHVAAATLDADGEEAVRADDGAKDDVVVDIMPPLPPLPAERAPPLPPPPAMIIPQPRAV
EVV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 213
Alignment file: K4AJ76.pir
Inward Open:
Template: 5CTG.pdb
Model structure: K4AJ76_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.3% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: K4AJ76_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 5.8% allowed .5% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: K4AJ76_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.8% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 101766631 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0032588 - trans-Golgi network membrane
GO:0012506 - vesicle membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0071836 - nectar secretion
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA