Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : K3ZE84
dbSWEET id: dbswt_906
Accession: K3ZE84
Uniprot status: Unreviewed
Organism: Setaria italica
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Panicodae ⇒ Paniceae ⇒ Cenchrinae ⇒ Setaria.
Sequence Information back to top
Sequence length: 236
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|K3ZE84|K3ZE84_SETIT|Unreviewed|Setaria_italica|236
MVNADAVRNIVGICGNIISFGLFLSPLPTFVQIVKKRDVEQFVPDPYLATFLNCALWVFY
GLPIVHPNSILVVTINGTGLAIEVVYLSVFFAYAPRPKRLKMLGVLAVELVFVVAIAAGV
LLGAHTHEKRSLIVGSVCIFFGTLMYAAPLTVMKRVITTKSVEYMPFTLSFVSFLNGICW
TTYALIRFDIFITIPNGIGTFLSSAQLILYFCYYGSTPKNDKSVELPVTASDDSNN
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: K3ZE84.pir
Inward Open:
Template: 5CTG.pdb
Model structure: K3ZE84_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 5.9% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: K3ZE84_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 4.8% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: K3ZE84_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 5.3% allowed 1.6% week .5% disallowed
Gene Informationback to top
Gene ID: 101773055 Total Exons: 3 Coding Exons: 3
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA