Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : K3ZDL9
dbSWEET id: dbswt_530
Accession: K3ZDL9
Uniprot status: Unreviewed
Organism: Setaria italica
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Panicodae ⇒ Paniceae ⇒ Cenchrinae ⇒ Setaria.
Sequence Information back to top
Sequence length: 246
Substrate Binding Site: TCWN CVV: 438 CHI: -2.6
Selectivity Filter: LSMT CVV: 414 CHI: 4.2
Fasta sequence:
>tr|K3ZDL9|K3ZDL9_SETIT|Unreviewed|Setaria_italica|246
MVTSIRVIVGIIASAVSIVLYAVPILTFKRVIKEASVREFSCVPYILALFSTLTYSWYGF
PVVSYGWENLSVSGTCSIGGIFETLFISIYIWFAPREKRKFVMLMVSLVLAIFCVTACVS
SLIIHTHHMRKVFVGSIGIVTAMSMYSSPLVAVKQVMRTKSVEFMPFYLSLFSFLTSLIW
MIYGILGRDPYITSPNAAGCFTGILQLAVYCIYSRCKEPPKKLSDTEQANDMDVVTTCEE
ANGFKP
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: K3ZDL9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: K3ZDL9_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.3% favored 3.1% allowed 1.6% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: K3ZDL9_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.3% favored 5.2% allowed .0% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: K3ZDL9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 5.2% allowed .5% week 1.6% disallowed
Gene Informationback to top
Gene ID: 101763235 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR020846: MFS_dom. IPR004316: SWEET_sugar_transpr.
Panther: NA