Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : K3ZDL9

dbSWEET id: dbswt_530

Accession:   K3ZDL9

Uniprot status:   Unreviewed

Organism:   Setaria italica

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Panicodae ⇒ Paniceae ⇒ Cenchrinae ⇒ Setaria.

Sequence Information back to top


Sequence length:   246

Substrate Binding Site:   TCWN           CVV:   438       CHI:   -2.6

Selectivity Filter:   LSMT           CVV:   414       CHI:   4.2

Fasta sequence:

>tr|K3ZDL9|K3ZDL9_SETIT|Unreviewed|Setaria_italica|246
MVTSIRVIVGIIASAVSIVLYAVPILTFKRVIKEASVREFSCVPYILALFSTLTYSWYGF
PVVSYGWENLSVSGTCSIGGIFETLFISIYIWFAPREKRKFVMLMVSLVLAIFCVTACVS
SLIIHTHHMRKVFVGSIGIVTAMSMYSSPLVAVKQVMRTKSVEFMPFYLSLFSFLTSLIW
MIYGILGRDPYITSPNAAGCFTGILQLAVYCIYSRCKEPPKKLSDTEQANDMDVVTTCEE
ANGFKP

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: K3ZDL9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  K3ZDL9_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.3% favored    3.1% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  K3ZDL9_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.3% favored    5.2% allowed    .0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  K3ZDL9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.2% allowed    .5% week    1.6% disallowed

Gene Informationback to top


Gene ID:   101763235     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR020846: MFS_dom. IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur