Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : K3ZCU3

dbSWEET id: dbswt_529

Accession:   K3ZCU3

Uniprot status:   Unreviewed

Organism:   Setaria italica

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Panicodae ⇒ Paniceae ⇒ Cenchrinae ⇒ Setaria.

Sequence Information back to top


Sequence length:   230

Substrate Binding Site:   CSWN           CVV:   418       CHI:   -2.7

Selectivity Filter:   LSMT           CVV:   414       CHI:   4.2

Fasta sequence:

>tr|K3ZCU3|K3ZCU3_SETIT|Unreviewed|Setaria_italica|230
MVPSIRVILGIIGCAVCMLLYSAPILTFKRVIKEASVGEFSCIPYILTLFSCLTYSWYGF
PVVSSGWKNLTVFLISSIGVLFEISFISIYLWFAPREKKKLVILIVSLVLAIFGMTVLIS
SFTIHTHHIRNIFVGSIGVLSAMLMYSSPLVAVKQVVRTRSVEFMPFYLSLFSFLTSLIW
MVYGLLGRDPYITSPNCVGCATGILQLVVYCIYRSKDRPKTQNNMENDME

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: K3ZCU3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  K3ZCU3_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    5.3% allowed    .5% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  K3ZCU3_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    4.2% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  K3ZCU3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    6.8% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur