Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : K3ZCU3
dbSWEET id: dbswt_529
Accession: K3ZCU3
Uniprot status: Unreviewed
Organism: Setaria italica
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Panicodae ⇒ Paniceae ⇒ Cenchrinae ⇒ Setaria.
Sequence Information back to top
Sequence length: 230
Substrate Binding Site: CSWN CVV: 418 CHI: -2.7
Selectivity Filter: LSMT CVV: 414 CHI: 4.2
Fasta sequence:
>tr|K3ZCU3|K3ZCU3_SETIT|Unreviewed|Setaria_italica|230
MVPSIRVILGIIGCAVCMLLYSAPILTFKRVIKEASVGEFSCIPYILTLFSCLTYSWYGF
PVVSSGWKNLTVFLISSIGVLFEISFISIYLWFAPREKKKLVILIVSLVLAIFGMTVLIS
SFTIHTHHIRNIFVGSIGVLSAMLMYSSPLVAVKQVVRTRSVEFMPFYLSLFSFLTSLIW
MVYGLLGRDPYITSPNCVGCATGILQLVVYCIYRSKDRPKTQNNMENDME
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: K3ZCU3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: K3ZCU3_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 5.3% allowed .5% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: K3ZCU3_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 4.2% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: K3ZCU3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 6.8% allowed 1.1% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA