| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : K3Z8D0
dbSWEET id: dbswt_361
Accession: K3Z8D0
Uniprot status: Unreviewed
Organism: Setaria italica
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Panicodae ⇒ Paniceae ⇒ Cenchrinae ⇒ Setaria.
Sequence Information back to top
Sequence length: 299
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: TSVS CVV: 344 CHI: 1.9
Fasta sequence:
>tr|K3Z8D0|K3Z8D0_SETIT|Unreviewed|Setaria_italica|299
MAGFSLQHPWAFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW
IFYALIKSNEVLLITINVAGFVIESIYVILYFVYADKKARWFTAKIMLGLNVGFFGAILL
FTLLVFHGDKRIVTLGWICVAFSVGVFVAPLSIIRVIQTRSVEYMPFSLSLTLTLSAVVW
FLYGLLIKDKYVALPNILGFTFGVVQMVLYVFYMNKTPVVADGKEAGKLPTAADEHVLVN
IAKLSPALPERSSGVHPVREMGLPTRTCAAEVAAATRAAPNRDVVDVLVSRQSPAVGVA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 215
Alignment file: K3Z8D0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: K3Z8D0_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 3.7% allowed 2.6% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: K3Z8D0_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 4.8% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: K3Z8D0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 6.9% allowed .5% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA