Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : K3YU75

dbSWEET id: dbswt_291

Accession:   K3YU75

Uniprot status:   Unreviewed

Organism:   Setaria italica

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Panicodae ⇒ Paniceae ⇒ Cenchrinae ⇒ Setaria.

Sequence Information back to top


Sequence length:   319

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|K3YU75|K3YU75_SETIT|Unreviewed|Setaria_italica|319
MAFLNMEQQTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML
WIFYALLKTGAVLLVTINGVGCVIETVYIAMYLVYAPRAARVLTAKMLLGLNVGVFGLVS
LVTMVLSNGNLRVHVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPFSLSFFLVLSAV
IWFAYGALKKDVFVAFPNVLGFVFGLAQMALYMAYRNRKPAAAVVMVEEVKLPEHVKEVA
AAPVAHEGRASCGAEVHPIDILPVEPPAAAVAAQDPQVAVAIDVEPVTCAAAAGRVDGDG
LVAPELAMIKPDTAIAVEV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   217

Alignment file: K3YU75.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  K3YU75_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.2% allowed    .0% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  K3YU75_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.2% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  K3YU75_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    4.8% allowed    1.6% week    1.1% disallowed

Gene Informationback to top


Gene ID:   101784612     Total Exons:   4     Coding Exons:   4

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur