| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : K3YU75
dbSWEET id: dbswt_291
Accession: K3YU75
Uniprot status: Unreviewed
Organism: Setaria italica
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Panicodae ⇒ Paniceae ⇒ Cenchrinae ⇒ Setaria.
Sequence Information back to top
Sequence length: 319
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|K3YU75|K3YU75_SETIT|Unreviewed|Setaria_italica|319
MAFLNMEQQTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML
WIFYALLKTGAVLLVTINGVGCVIETVYIAMYLVYAPRAARVLTAKMLLGLNVGVFGLVS
LVTMVLSNGNLRVHVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPFSLSFFLVLSAV
IWFAYGALKKDVFVAFPNVLGFVFGLAQMALYMAYRNRKPAAAVVMVEEVKLPEHVKEVA
AAPVAHEGRASCGAEVHPIDILPVEPPAAAVAAQDPQVAVAIDVEPVTCAAAAGRVDGDG
LVAPELAMIKPDTAIAVEV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 217
Alignment file: K3YU75.pir
Inward Open:
Template: 5CTG.pdb
Model structure: K3YU75_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.2% allowed .0% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: K3YU75_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.2% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: K3YU75_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 4.8% allowed 1.6% week 1.1% disallowed
Gene Informationback to top
Gene ID: 101784612 Total Exons: 4 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number



Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA