Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : K3YIR9
dbSWEET id: dbswt_75
Accession: K3YIR9
Uniprot status: Unreviewed
Organism: Setaria italica
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Panicodae ⇒ Paniceae ⇒ Cenchrinae ⇒ Setaria.
Sequence Information back to top
Sequence length: 307
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|K3YIR9|K3YIR9_SETIT|Unreviewed|Setaria_italica|307
MAGGLLHMAHPAITLSGVAGNIISFLVFLAPVTTFLQVYRKKTTGGFSSVPYVVALFSSV
LWIFYALVKTNSRPLLTINAFGCGVELAYIVFYLAYAPRKARLRTLAYFFLMDVGAFGLI
VVVTLFGVRKHLQVKFLGSVCLAFSMAVFVAPLSIIVKVVKTKSVEFLPISLSFCLTLSA
VAWFCYGLFTKDPFVMYPNVGGFFFSCVQMGLYFWYRKPRATNAVLPTTGDGGAAAPSVQ
VQGQVIELAPNTIAILSVSPIPIVGVHKIEVVDGQHKDAAVAAEACRMAAANPEGPPPQV
IEIVPAA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 6 Model end: 218
Alignment file: K3YIR9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: K3YIR9_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 4.3% allowed .5% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: K3YIR9_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 7.0% allowed .0% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: K3YIR9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 7.5% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 101768594 Total Exons: 4 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0005887 - integral component of plasma membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0006825 - copper ion transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA