Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : K3YIR9

dbSWEET id: dbswt_75

Accession:   K3YIR9

Uniprot status:   Unreviewed

Organism:   Setaria italica

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Panicodae ⇒ Paniceae ⇒ Cenchrinae ⇒ Setaria.

Sequence Information back to top


Sequence length:   307

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|K3YIR9|K3YIR9_SETIT|Unreviewed|Setaria_italica|307
MAGGLLHMAHPAITLSGVAGNIISFLVFLAPVTTFLQVYRKKTTGGFSSVPYVVALFSSV
LWIFYALVKTNSRPLLTINAFGCGVELAYIVFYLAYAPRKARLRTLAYFFLMDVGAFGLI
VVVTLFGVRKHLQVKFLGSVCLAFSMAVFVAPLSIIVKVVKTKSVEFLPISLSFCLTLSA
VAWFCYGLFTKDPFVMYPNVGGFFFSCVQMGLYFWYRKPRATNAVLPTTGDGGAAAPSVQ
VQGQVIELAPNTIAILSVSPIPIVGVHKIEVVDGQHKDAAVAAEACRMAAANPEGPPPQV
IEIVPAA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   6     Model end:   218

Alignment file: K3YIR9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  K3YIR9_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.2% favored    4.3% allowed    .5% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  K3YIR9_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    7.0% allowed    .0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  K3YIR9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    7.5% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   101768594     Total Exons:   4     Coding Exons:   4

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0005887 - integral component of plasma membrane

GO:0008515 - sucrose transmembrane transporter activity

GO:0006825 - copper ion transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur