| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : K3XLZ5
dbSWEET id: dbswt_600
Accession: K3XLZ5
Uniprot status: Unreviewed
Organism: Setaria italica
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Panicodae ⇒ Paniceae ⇒ Cenchrinae ⇒ Setaria.
Sequence Information back to top
Sequence length: 210
Substrate Binding Site: CNFT CVV: 410 CHI: 1.1
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|K3XLZ5|K3XLZ5_SETIT|Unreviewed|Setaria_italica|210
MSSLYDISCFAAGVAGNIFALALFLSPVPTFKRVVKAKSTERFDGLPYLLSLLNCCICLW
YGLPWVSDGGRTLVATVNGTGALFQLAYISLFIFYADSRSTRLKITGILLLEVFVFAFVA
HASIAFLDQPARQLFIGGVSMASLISMFASPLAVMGLVIRTECVEFMPFYLSLSTFLMSA
SFTMYGLLLRDFFIYVSTRFVLISAYAFMN
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 211
Alignment file: K3XLZ5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: K3XLZ5_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 4.3% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: K3XLZ5_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 3.7% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: K3XLZ5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 7.0% allowed 1.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA