| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : K3XL47
dbSWEET id: dbswt_542
Accession: K3XL47
Uniprot status: Unreviewed
Organism: Setaria italica
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Panicodae ⇒ Paniceae ⇒ Cenchrinae ⇒ Setaria.
Sequence Information back to top
Sequence length: 257
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMS CVV: 417 CHI: 1.4
Fasta sequence:
>tr|K3XL47|K3XL47_SETIT|Unreviewed|Setaria_italica|257
MVPNTVRVAVGILGNAASMLLYAAPILTFRRVVKKGNVEEFSCVPYILALFNCLLYTWYG
LPVVSSGWENFPVSTINGVGILLEITFISIYIWFAPSKKKRFALQLVIPVVTLFGLTAFF
SSFMVHTHRMRKVFVGSVGLVASISMYSSPMVAAKQVITTKSVEFMPLYLSLFSFLSSAL
WMIYGLLGKDLFIASPNFVGVPMGILQLVLYCIYRRSDGAAGKLHATAIDQEKGLKAVVA
MHPQELGVTKPEAEGQK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 216
Alignment file: K3XL47.pir
Inward Open:
Template: 5CTG.pdb
Model structure: K3XL47_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 3.2% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: K3XL47_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.9% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: K3XL47_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.9% favored 8.0% allowed 2.1% week .0% disallowed
Gene Informationback to top
Gene ID: 101769378 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA