Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : K1NU75
dbSWEET id: dbswt_1846
Accession: K1NU75
Uniprot status: Unreviewed
Organism: Lactobacillus crispatus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 111
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|K1NU75|K1NU75_9LACO|Unreviewed|Lactobacillus crispatus| 111
MIFAIDSSFSYNEAQRSDLLKKFKGLDRKTVLTIGRIGSVLSVLMYVSYIPQIINNLNGN
YGNPVQPLVAAINCTIWVLYAILGEKKDWPLFTANFPGIIFGLITFFTSLH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 35 Model end: 111 Inward Open: Template: 4X5M.pdb Model structure: K1NU75_inward.pdb Alignment file: K1NU75_inw.pir Procheck score ⇒ Ramachandran plot: 87.3% favored 10.3% allowed 2.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: K1NU75_outward.pdb Alignment file: K1NU75_out.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 9.5% allowed .0% week .8% disallowed Occluded: Model structure: K1NU75_occluded.pdb Alignment file: K1NU75_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA