Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : K0XPC4

dbSWEET id: dbswt_1845

Accession:   K0XPC4

Uniprot status:   Unreviewed

Organism:   Lachnoanaerobaculum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Clostridia ⇒ Clostridiales ⇒ Lachnospiraceae ⇒ Lachnoanaerobaculum.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SSSS           CVV:   292       CHI:   -3.2

Fasta sequence:

>tr|K0XPC4|K0XPC4_9FIRM|Unreviewed|Lachnoanaerobaculum|87
MTKKRINTFIGSIGAFIGVLVFLSYIPQIIANIGGEKSQPLQPLVAAISCLLWVIYGLTN
EHKIDYILIIPNAAGVVFGFLTFITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  K0XPC4_inward.pdb    Alignment file: K0XPC4_inw.pir

Procheck score ⇒ Ramachandran plot: 89.8% favored    9.4% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  K0XPC4_outward.pdb    Alignment file: K0XPC4_out.pir

Procheck score ⇒ Ramachandran plot: 90.6% favored    7.8% allowed    1.6% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  K0XPC4_occluded.pdb    Alignment file: K0XPC4_occ.pir

Procheck score ⇒ Ramachandran plot: 89.8% favored    7.0% allowed    1.6% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur