Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : K0XPC4
dbSWEET id: dbswt_1845
Accession: K0XPC4
Uniprot status: Unreviewed
Organism: Lachnoanaerobaculum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Clostridia ⇒ Clostridiales ⇒ Lachnospiraceae ⇒ Lachnoanaerobaculum.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SSSS CVV: 292 CHI: -3.2
Fasta sequence:
>tr|K0XPC4|K0XPC4_9FIRM|Unreviewed|Lachnoanaerobaculum|87
MTKKRINTFIGSIGAFIGVLVFLSYIPQIIANIGGEKSQPLQPLVAAISCLLWVIYGLTN
EHKIDYILIIPNAAGVVFGFLTFITAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: K0XPC4_inward.pdb Alignment file: K0XPC4_inw.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 9.4% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: K0XPC4_outward.pdb Alignment file: K0XPC4_out.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 7.8% allowed 1.6% week .0% disallowed Occluded: Model structure: K0XPC4_occluded.pdb Alignment file: K0XPC4_occ.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 7.0% allowed 1.6% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA