| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : K0NEI5
dbSWEET id: dbswt_1844
Accession: K0NEI5
Uniprot status: Unreviewed
Organism: Lactobacillus equicursoris
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 79
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|K0NEI5|K0NEI5_9LACO|Unreviewed|Lactobacillus equicursoris|79
MLLGRVASAISVLMYVSYIAQIASNLSGQKGNPVQPLVAAINASLWVAYGWNAPKRDWPI
IVANAPGIVLGLATAITCF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 80 Inward Open: Template: 4X5M.pdb Model structure: K0NEI5_inward.pdb Alignment file: K0NEI5_inw.pir Procheck score ⇒ Ramachandran plot: 85.9% favored 11.7% allowed 1.6% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: K0NEI5_outward.pdb Alignment file: K0NEI5_out.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 6.2% allowed 1.6% week .0% disallowed Occluded: Model structure: K0NEI5_occluded.pdb Alignment file: K0NEI5_occ.pir Procheck score ⇒ Ramachandran plot: 89.1% favored 9.4% allowed 1.6% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA