Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : K0NEI5

dbSWEET id: dbswt_1844

Accession:   K0NEI5

Uniprot status:   Unreviewed

Organism:   Lactobacillus equicursoris

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   79

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|K0NEI5|K0NEI5_9LACO|Unreviewed|Lactobacillus equicursoris|79
MLLGRVASAISVLMYVSYIAQIASNLSGQKGNPVQPLVAAINASLWVAYGWNAPKRDWPI
IVANAPGIVLGLATAITCF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   80

Inward Open:

Template:   4X5M.pdb

Model structure:  K0NEI5_inward.pdb    Alignment file: K0NEI5_inw.pir

Procheck score ⇒ Ramachandran plot: 85.9% favored    11.7% allowed    1.6% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  K0NEI5_outward.pdb    Alignment file: K0NEI5_out.pir

Procheck score ⇒ Ramachandran plot: 92.2% favored    6.2% allowed    1.6% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  K0NEI5_occluded.pdb    Alignment file: K0NEI5_occ.pir

Procheck score ⇒ Ramachandran plot: 89.1% favored    9.4% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur