Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : K0BBR8

dbSWEET id: dbswt_2080

Accession:   K0BBR8

Uniprot status:   Unreviewed

Organism:   Candidatus Nitrosopumilus

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Thaumarchaeota ⇒ Nitrosopumilales ⇒ Nitrosopumilaceae;Nitrosopumilus.

Sequence Information back to top


Sequence length:   94

Substrate Binding Site:   SNSN           CVV:   338       CHI:   -8.6

Selectivity Filter:   GGGG           CVV:   192       CHI:   -1.6

Fasta sequence:

>tr|K0BBR8|K0BBR8_9ARCH|Unreviewed|Candidatus Nitrosopumilus|94
MEVDGTFLTILGITAGIFILMGWIEQIYKGYKTKRLKDVSKFLMIFIAAGSILWLIYGII
VDDVFIIGTNMSGLILMIIVLGMKKRYDMHAKPS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   9     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  K0BBR8_inward.pdb    Alignment file: K0BBR8_inw.pir

Procheck score ⇒ Ramachandran plot: 93.9% favored    4.5% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  K0BBR8_outward.pdb    Alignment file: K0BBR8_out.pir

Procheck score ⇒ Ramachandran plot: 93.2% favored    6.8% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  K0BBR8_occluded.pdb    Alignment file: K0BBR8_occ.pir

Procheck score ⇒ Ramachandran plot: 95.5% favored    4.5% allowed    .0% week    .0% disallowed

Gene Informationback to top


Gene ID:   13696875

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur