Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : K0BBR8
dbSWEET id: dbswt_2080
Accession: K0BBR8
Uniprot status: Unreviewed
Organism: Candidatus Nitrosopumilus
Kingdom: Archaea
Taxonomy back to top
Archaea ⇒ Thaumarchaeota ⇒ Nitrosopumilales ⇒ Nitrosopumilaceae;Nitrosopumilus.
Sequence Information back to top
Sequence length: 94
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|K0BBR8|K0BBR8_9ARCH|Unreviewed|Candidatus Nitrosopumilus|94
MEVDGTFLTILGITAGIFILMGWIEQIYKGYKTKRLKDVSKFLMIFIAAGSILWLIYGII
VDDVFIIGTNMSGLILMIIVLGMKKRYDMHAKPS
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 9 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: K0BBR8_inward.pdb Alignment file: K0BBR8_inw.pir Procheck score ⇒ Ramachandran plot: 93.9% favored 4.5% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: K0BBR8_outward.pdb Alignment file: K0BBR8_out.pir Procheck score ⇒ Ramachandran plot: 93.2% favored 6.8% allowed .0% week .0% disallowed Occluded: Model structure: K0BBR8_occluded.pdb Alignment file: K0BBR8_occ.pir Procheck score ⇒ Ramachandran plot: 95.5% favored 4.5% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA