Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : J9YF64
dbSWEET id: dbswt_1843
Accession: J9YF64
Uniprot status: Unreviewed
Organism: Leuconostoc gelidum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Leuconostoc.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|J9YF64|J9YF64_LEUGJ|Unreviewed|Leuconostoc gelidum|86
MKHEKFIEYLSWTATAMSILMYVSYIPQIIDNLSGSKGNPVQPLVAAVNCGLWVLYGLIK
EDRDIPLATANFPGIIFGLVTFLTAI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: J9YF64_inward.pdb Alignment file: J9YF64_inw.pir Procheck score ⇒ Ramachandran plot: 88.1% favored 8.7% allowed 2.4% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: J9YF64_outward.pdb Alignment file: J9YF64_out.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 7.1% allowed 1.6% week .0% disallowed Occluded: Model structure: J9YF64_occluded.pdb Alignment file: J9YF64_occ.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 8.7% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA