Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : J9JMD2

dbSWEET id: dbswt_1206

Accession:   J9JMD2

Uniprot status:   Unreviewed

Organism:   Acyrthosiphon pisum

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Paraneoptera ⇒ Hemiptera ⇒ Sternorrhyncha ⇒ Aphidiformes ⇒ Aphidoidea ⇒ Aphididae ⇒ Macrosiphini ⇒ Acyrthosiphon.

Sequence Information back to top


Sequence length:   211

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   TMLV           CVV:   446       CHI:   9.2

Fasta sequence:

>tr|J9JMD2|J9JMD2_ACYPI|Unreviewed|Acyrthosiphon_pisum|211
MSLTDTVGKCAAIATIGTFFAPVLICRDIIKNKSTKNVDPTPFVGGMAMSILMIKNGLLM
NDPNIIPVNIFGFILNLIYFLVFYFFTADSKPLFSMLTKATLFTGVLWGYSTIEDEKLIE
YRFGVILTVLMLTLIGAPLFSLNDIIKNKDASMLPFPMIASGTFVGFLWLIYGLLIDNIF
IKVQNIVSVILCLIQLGLIFKYPKPESKKLD

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   204

Alignment file: J9JMD2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  J9JMD2_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.2% favored    8.4% allowed    .6% week    2.8% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  J9JMD2_outward.pdb

Procheck score ⇒ Ramachandran plot: 88.2% favored    9.0% allowed    2.2% week    .6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  J9JMD2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    6.7% allowed    .6% week    .0% disallowed

Gene Informationback to top


Gene ID:   100160045     Total Exons:   7     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur