Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : J7T7Y3

dbSWEET id: dbswt_1840

Accession:   J7T7Y3

Uniprot status:   Unreviewed

Organism:   Streptococcus salivarius

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.

Sequence Information back to top


Sequence length:   104

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|J7T7Y3|J7T7Y3_STRSL|Unreviewed|Streptococcus salivarius| 104
MYYFLRCTRKKFIKEESRMSDKQMKTLGWVATFMSVMMYVSYVPQIMDNLSGHKGNFIQP
LVAAINCSLWVYYGLFKKERDLPLAAANAPGIVFGLITALTALF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   28     Model end:   104

Inward Open:

Template:   4X5M.pdb

Model structure:  J7T7Y3_inward.pdb    Alignment file: J7T7Y3_inw.pir

Procheck score ⇒ Ramachandran plot: 89.2% favored    10.0% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  J7T7Y3_outward.pdb    Alignment file: J7T7Y3_out.pir

Procheck score ⇒ Ramachandran plot: 90.0% favored    6.9% allowed    .8% week    2.3% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  J7T7Y3_occluded.pdb    Alignment file: J7T7Y3_occ.pir

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.2% allowed    1.5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur