| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : J7T7Y3
dbSWEET id: dbswt_1840
Accession: J7T7Y3
Uniprot status: Unreviewed
Organism: Streptococcus salivarius
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 104
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|J7T7Y3|J7T7Y3_STRSL|Unreviewed|Streptococcus salivarius| 104
MYYFLRCTRKKFIKEESRMSDKQMKTLGWVATFMSVMMYVSYVPQIMDNLSGHKGNFIQP
LVAAINCSLWVYYGLFKKERDLPLAAANAPGIVFGLITALTALF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 28 Model end: 104 Inward Open: Template: 4X5M.pdb Model structure: J7T7Y3_inward.pdb Alignment file: J7T7Y3_inw.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 10.0% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: J7T7Y3_outward.pdb Alignment file: J7T7Y3_out.pir Procheck score ⇒ Ramachandran plot: 90.0% favored 6.9% allowed .8% week 2.3% disallowed Occluded: Model structure: J7T7Y3_occluded.pdb Alignment file: J7T7Y3_occ.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 6.2% allowed 1.5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA